Transcript | Ll_transcript_372158 |
---|---|
CDS coordinates | 312-632 (+) |
Peptide sequence | MYLWPKALEVQIMDPAKDVAVFNAMIDRYVKLGCMELAKDLFDRMVDKNVISWISIIYGYCQNDAVDSARLMFDVMNEKNVFTWNAMIGGYCHNKRSHEVLRLFRKM |
ORF Type | 3prime_partial |
Blastp | Pentatricopeptide repeat-containing protein At2g44880 from Arabidopsis with 50.53% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At2g44880 from Arabidopsis with 50.53% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT2G44880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413271.1) |
Pfam | PPR repeat (PF01535.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer