Protein coding transcript 34092

• Transcript: Ll_transcript_372166
• CDS coordinates: 315-791 (+)
• Peptide sequence: MPYRDVAVFNAMIDRYVKLGCMELAKDLFDRMVDKNVISWISIIYGYCQNDAVDSARLMFDVTNEKTVFTWNAMIGGYCHNKRSHEVLRLFRKMQLRASMEPNEIIVSSVHLVIADLGALDLGGWIHRFVHMKRLDRFVNVCTMLVDMYAKRMIRRRN*
• ORF Type: complete

Annotations of Ll_transcript_372166

• Blastp: Pentatricopeptide repeat-containing protein At2g44880 from Arabidopsis with 48.03% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g44880 from Arabidopsis with 48.39% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G44880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413271.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;