Transcript | Ll_transcript_371144 |
---|---|
CDS coordinates | 218-520 (+) |
Peptide sequence | MNMSYMVGFGRKYPQQLHHRGSSIPSIRDHPAKVGCNEGQSNYLNSPNPNPNIHVGAIVGGPDSNDHFNDARSDFSHNEPAIYINAAFVGSVASLLGKNK* |
ORF Type | complete |
Blastp | Endoglucanase from Phaseolus with 77.78% of identity |
---|---|
Blastx | Endoglucanase from Phaseolus with 77.78% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (PHAVU_002G160200g) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420569.1) |
Pfam | Glycosyl hydrolase family 9 (PF00759.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer