Protein coding transcript 34142

• Transcript: Ll_transcript_371148
• CDS coordinates: 62-1003 (+)
• Peptide sequence: MNYSLVASGLLLWCAIVGHNGLAMVMDEKVVNASSSYSSYKDALGKAILFFEGQRSGKLPSKQRVHWRGDSALSDGNLQNVDLSGGYYDAGDNVKFGWTVSFSMSLLSWSAIEFRAQLRSAKELGHVLDAIRWGSDFILKSHTSPTTLYTQVGDGNGDHQCWERPEDMDTVRTVYKIDANSPGTEVAADAAAALASASIVFKKADPKYSSILLAKSKSLFDLADKFRGSYSASCPFYCSFSSYQDELLWAASWLYKASGEMKYLDYALSNQGWSHGVAEFSWDNKFIGAQTLLTKVFNLYIYNLPYHQSFNYP*
• ORF Type: complete

Annotations of Ll_transcript_371148

• Blastp: Endoglucanase from Phaseolus with 71.81% of identity
• Blastx: Endoglucanase from Phaseolus with 71.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (PHAVU_002G160200g)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420569.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;