Protein coding transcript 34154

• Transcript: Ll_transcript_371175
• CDS coordinates: 697-1386 (+)
• Peptide sequence: MLSISFFDLAHNALNALGFLKGNLWFFAGVIFFAVIANFIPEPTLAPTSNGKNRKKNGDDGGKDVLKKHRRQVLYSGIITAIGISLHNFPEGMAVFLGSLKGLRVGINLALAIALHNIPEGVAVALPVYFATQSKWQAFKLATLSGFAEPLGVIIVAYLFPSSLSPEVLEGLLGSVGGVMAFLTLHEMLPLAFDYAGQKQSVKAVFFGMAFMSASLYFLSISLPEEISL*
• ORF Type: complete

Annotations of Ll_transcript_371175

• Blastp: Zinc transporter ZTP29 from Arabidopsis with 84.28% of identity
• Blastx: Zinc transporter ZTP29 from Arabidopsis with 83.9% of identity
• Eggnog: zinc transporter(COG0428)
• Kegg: Link to kegg annotations (AT3G20870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436582.1)
• Pfam: ZIP Zinc transporter (PF02535.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;