Protein coding transcript 34203

• Transcript: Ll_transcript_371742
• CDS coordinates: 1020-1637 (+)
• Peptide sequence: MGALQWDSVVNHRQGWRLITCIWLHAGLIHLAANMFSLIFIGIRLEQQFGFVRIGIIYLLSGFGGSVLSSLFIRNNISVGASGALFGLLGAMLSELITNWTIYSNKAAALLTLLVIVVINLAIGILPHIDNFAHIGGFLTGLLLGFILLARPQYGWLEQRHLPAGVRRKSKFKAYQYTLWIVSLVLLVAGLVPSFLRFSYAVVLF*
• ORF Type: complete

Annotations of Ll_transcript_371742

• Blastp: RHOMBOID-like protein 3 from Arabidopsis with 75% of identity
• Blastx: RHOMBOID-like protein 3 from Arabidopsis with 74.87% of identity
• Eggnog: rhomboid family(COG0705)
• Kegg: Link to kegg annotations (AT5G07250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449627.1)
• Pfam: Rhomboid family (PF01694.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;