Protein coding transcript 34242

• Transcript: Ll_transcript_371695
• CDS coordinates: 251-889 (+)
• Peptide sequence: MVADVDLVCKQSVATLDVKYFPNKEIKNHEIEGEHAISPPSFDRVRASESVSAKLSTSLEDVKPGDRISDDALESAVMQFVPCIRSGSFVDIGPRRYMEDEHIRIDDLSSHLGSLYNFPKPSAFYGVFDGHGGPEAAAYVRKNIMKFFFEDASFPQTSEVDNVFLQELENSLTKAFLLADSALADECSVNSSSGTTALTAFIFGRYVHALNT*
• ORF Type: complete

Annotations of Ll_transcript_371695

• Blastp: Probable protein phosphatase 2C 49 from Arabidopsis with 52.07% of identity
• Blastx: Probable protein phosphatase 2C 49 from Arabidopsis with 52.07% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT3G62260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452334.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;