Protein coding transcript 34245

• Transcript: Ll_transcript_371705
• CDS coordinates: 251-901 (+)
• Peptide sequence: MVADVDLVCKQSVATLDVKYFPNKEIKNHEIEGEHAISPPSFDRVRASESVSAKLSTSLEDVKPGDRISDDALESAVMQFVPCIRSGSFVDIGPRRYMEDEHIRIDDLSSHLGSLYNFPKPSAFYGVFDGHGGPEAAAYVRKNIMKFFFEDASFPQTSEVDNVFLQELENSLTKAFLLADSALADECSVNSSSGTTALTAFIFGRLLMVANAGDCRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_371705

• Blastp: Probable protein phosphatase 2C 49 from Arabidopsis with 55.61% of identity
• Blastx: Probable protein phosphatase 2C 49 from Arabidopsis with 55.61% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT3G62260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452334.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;