Protein coding transcript 34302

• Transcript: Ll_transcript_371010
• CDS coordinates: 655-1263 (+)
• Peptide sequence: MSKGYINYLIIFYCNLGQSSIIGYALYALWLVVLFYLLGDTASNYFCNNLEGLSKILGLSPTIAGVTLLSLGNGAPDFFATVVSFTSSNNGAVGLNSILGGAFFVSSAVLGIITILVSSQNVAVEKGSFIKNVLFFLFSLTILIIIISIGEISFFASICYVSIYFLYVFSVSATHFIYGWGNKKEKEFEFSSEDLLEYGIPLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_371010

• Blastp: Cation/calcium exchanger 1 from Arabidopsis with 55.45% of identity
• Blastx: Cation/calcium exchanger 1 from Arabidopsis with 55.07% of identity
• Eggnog: exchanger(COG0530)
• Kegg: Link to kegg annotations (AT5G17860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437480.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;