Protein coding transcript 34332

• Transcript: Ll_transcript_371758
• CDS coordinates: 3-626 (+)
• Peptide sequence: QIFSLSHHKIRMGLCTVQSINASAPLLLPNPKSSIPIRQIPTIRTASLLSRSICLRNVLSKATTSEDSSSKTSQFFDEKRDNAVVSDDVEAVDKKGFNGINPKQELPVVEQEGLSLNLLDNLNIKFDADDTASIVLYAGGVVVSLWLTSAVIGAIDSIPLFPKLLEAVGLGYTIWFTSRYLLFKKNRDELTAKIEELKEQVLGSDDN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_371758

• Blastp: Protein CURVATURE THYLAKOID 1D, chloroplastic from Arabidopsis with 43.02% of identity
• Blastx: Protein CURVATURE THYLAKOID 1D, chloroplastic from Arabidopsis with 43.02% of identity
• Eggnog: NA(ENOG4111UCM)
• Kegg: Link to kegg annotations (AT4G38100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424296.1)
• Pfam: CAAD domains of cyanobacterial aminoacyl-tRNA synthetase (PF14159.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;