Protein coding transcript 34364

• Transcript: Ll_transcript_371553
• CDS coordinates: 2-331 (+)
• Peptide sequence: SDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGVIEPTLRILAMKYNCDKMICRKCYARLHPRATNCRKKKCGHTNNLRPKKKLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_371553

• Blastp: Ubiquitin-60S ribosomal protein L40 from Sophophora with 96.33% of identity
• Blastx: Ubiquitin-60S ribosomal protein L40 from Sophophora with 96.33% of identity
• Eggnog: Ribosomal protein(COG1552)
• Kegg: Link to kegg annotations (Dmel_CG2960)
• CantataDB: Link to cantataDB annotations (CNT0000474)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007162922.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;