Transcript | Ll_transcript_372693 |
---|---|
CDS coordinates | 389-700 (+) |
Peptide sequence | MKQELKFVFAFVISLLWIQHSLCDKPSNTSVLSQWKCRCSSFPGNQSYSLANCSKSCDCHSEESTSIWTCICDPDGLPEVEADGHSPKCFTACNCTSGTVRMSL |
ORF Type | 3prime_partial |
Blastp | Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 32.69% of identity |
---|---|
Blastx | Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 32.69% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G28250) |
CantataDB | Link to cantataDB annotations (CNT0000711) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448749.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer