Protein coding transcript 34464

• Transcript: Ll_transcript_372693
• CDS coordinates: 389-700 (+)
• Peptide sequence: MKQELKFVFAFVISLLWIQHSLCDKPSNTSVLSQWKCRCSSFPGNQSYSLANCSKSCDCHSEESTSIWTCICDPDGLPEVEADGHSPKCFTACNCTSGTVRMSL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_372693

• Blastp: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 32.69% of identity
• Blastx: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 32.69% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G28250)
• CantataDB: Link to cantataDB annotations (CNT0000711)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448749.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;