Protein coding transcript 34466

• Transcript: Ll_transcript_372697
• CDS coordinates: 2089-2436 (+)
• Peptide sequence: MKPRFKVAVAVAVALVVSLIGIQPSFCGEPSDHGLNKWKCRCSSFLGNQRHSLANCSESCDCHSDAKESSSKWTCICDRNGFPKVAADGHSNNCFKSCNCTWGTVRMPPGSKKHIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_372697

• Blastp: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 36.89% of identity
• Blastx: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 40.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G28250)
• CantataDB: Link to cantataDB annotations (CNT0000711)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447854.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;