Protein coding transcript 3455

• Transcript: Ll_transcript_297962
• CDS coordinates: 152-511 (+)
• Peptide sequence: MAGLQRSAVSFRRQGSSGFVWDDKFLTEEFNKVNQQNEEQQHEQGEIKAHATTSLGSVNTTMERSRSTGGSSRGYRTGKVSPAIDPPSPKLSACGFCSAFGKHGDKGSQRSRPGKRRIR*
• ORF Type: complete

Annotations of Ll_transcript_297962

• Blastp: MAPK kinase substrate protein At1g80180 from Arabidopsis with 48.55% of identity
• Blastx: MAPK kinase substrate protein At1g80180 from Arabidopsis with 42.75% of identity
• Eggnog: NA(ENOG410ZGQ8)
• Kegg: Link to kegg annotations (AT1G80180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443387.1)
• Pfam: Domain of unknown function (DUF4666) (PF15697.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;