Protein coding transcript 34561

• Transcript: Ll_transcript_309878
• CDS coordinates: 1178-1852 (+)
• Peptide sequence: MISCISPNAGSCEHTLNTLRYADRVKSLSKSGNPRKDQAPNPVIQTNKEVLSTSPIPSSAGAEDFSDQRQEVKTVDMDRKVIEKQNYSSAAEVGIQPSSFSSSYLFNGREGRDLASASINKKFEMKNSYSDSTSQKINSYSLNDTDEEMQRVSPPRRKGYKDEKPERSTNRLKRDVSGSERFTANFKQQSTGNYNTVTSGSWQSETEPIPNGNINAIPEVCQLF*
• ORF Type: complete

Annotations of Ll_transcript_309878

• Blastp: Kinesin-like protein KIN-13A from Arabidopsis with 43.61% of identity
• Blastx: Kinesin-like protein KIN-13A from Arabidopsis with 54.99% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G16630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463571.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;