Protein coding transcript 34635

• Transcript: Ll_transcript_309533
• CDS coordinates: 1545-2135 (+)
• Peptide sequence: MYSLESYKDSAQSFMCTLIPESPSSHIEYTPGGLVYRPGGSNLQHATSIAFLELVYANYLTHTSQDLNCGNVYVTAQTLRRHAKKQVDYILGDNPMGLSYMVGYSGYYPQRIHHRGSSLPSIKDNPQFIGCKEGSMYYNSTNPNPNVLVGAIVGGPGENDDYLDDRVDFRKSEPTTYINAPFVGVLAYFAANPNFT*
• ORF Type: complete

Annotations of Ll_transcript_309533

• Blastp: Endoglucanase 24 from Arabidopsis with 73.06% of identity
• Blastx: Endoglucanase 24 from Arabidopsis with 74% of identity
• Eggnog: endo-glucanase(ENOG410YC2H)
• Kegg: Link to kegg annotations (AT4G39010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451001.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;