Protein coding transcript 34701

• Transcript: Ll_transcript_310773
• CDS coordinates: 4012-4575 (+)
• Peptide sequence: MQMVHYNSGGLRLNPNLYESGKICLSLLNTWTGTGTEVWNPGASTILQLLLSLQALVLNDKPYFNEAGYDQQIGRAEGEKNSVSYNENVFLVTSKSMLYLLRKPPKHFEILVEEHFRKRSRHILRARKACLEGAPIGCAFGSGKTEHENQKGTSTGFKIMLAKIFPKLVEAFSDKGIDCSQFVDMQK*
• ORF Type: complete

Annotations of Ll_transcript_310773

• Blastp: Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 42.78% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 42.78% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XQ7W)
• Kegg: Link to kegg annotations (AT2G33770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423805.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;