Protein coding transcript 34711

• Transcript: Ll_transcript_310759
• CDS coordinates: 3815-4480 (+)
• Peptide sequence: MDLMRAAIVGASGTPYHDGLFFFDICFPPEYPSEPPMVHFNSGGLRLNPNLYESGKVCLSLLNTWTGTSTEVWNPGASTILQVLLSLQALVLNDKPYFNEAGYDQQIGRAEGERNSVSYNENAFLVTCKSMLYLLRKPPKHFETVVEEHFRQRSKHILVACKAYLEGVTIGCAFGSGNPEDENQKGTSTGFKIMLSKLFPKLVEAFSDKGIDCSQFNELQK*
• ORF Type: complete

Annotations of Ll_transcript_310759

• Blastp: Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 43.28% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 43.34% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XQ7W)
• Kegg: Link to kegg annotations (AT2G33770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432309.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;