Transcript | Ll_transcript_310765 |
---|---|
CDS coordinates | 4637-5194 (+) |
Peptide sequence | MVHFNSGGLRLNPNLYESGKVCLSLLNTWTGTSTEVWNPGASTILQVLLSLQALVLNDKPYFNEAGYDQQIGRAEGERNSVSYNENAFLVTCKSMLYLLRKPPKHFETVVEEHFRQRSKHILVACKAYLEGVTIGCAFGSGNPEDENQKGTSTGFKIMLSKLFPKLVEAFSDKGIDCSQFNELQK* |
ORF Type | complete |
Blastp | Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 48.28% of identity |
---|---|
Blastx | Probable ubiquitin-conjugating enzyme E2 24 from Arabidopsis with 48.39% of identity |
Eggnog | ubiquitin-conjugating enzyme(ENOG410XQ7W) |
Kegg | Link to kegg annotations (AT2G33770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425570.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer