Protein coding transcript 34736

• Transcript: Ll_transcript_310421
• CDS coordinates: 556-885 (+)
• Peptide sequence: MEQQLESLLDAVVSNCRPMTLVEKQQLQRLIQKLPAENLDRVVQIICRSRPVKEQKTDKIFVDLEKEDNATLWRLYYYIEAFEKAKILSRCGCGCGLHSVLHLPHLIRH*
• ORF Type: complete

Annotations of Ll_transcript_310421

• Blastp: Transcription factor GTE5, chloroplastic from Arabidopsis with 40.85% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 41.09% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT1G17790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438698.1)
• Pfam: Bromodomain extra-terminal - transcription regulation (PF17035.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;