Protein coding transcript 34794

• Transcript: Ll_transcript_311471
• CDS coordinates: 160-609 (+)
• Peptide sequence: MVFPQEESLVYDVRLSSVGPGRVTGSDVFHNPSGLDLAMKLHYLKIVYFFESEPAQGLTTPKVKESLFYLLNHYFIICGRFRRSESGRPIIKCNDCGVRFIEAKCKITLDEWLATIDWPSYKLLVSQQVIGPELSFSPPVLMQSNCQTG*
• ORF Type: complete

Annotations of Ll_transcript_311471

• Blastp: Protein ECERIFERUM 26 from Arabidopsis with 48.2% of identity
• Blastx: Protein ECERIFERUM 26 from Arabidopsis with 48.2% of identity
• Eggnog: Transferase family(ENOG410YCVD)
• Kegg: Link to kegg annotations (AT4G13840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460619.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;