Transcript | Ll_transcript_311471 |
---|---|
CDS coordinates | 160-609 (+) |
Peptide sequence | MVFPQEESLVYDVRLSSVGPGRVTGSDVFHNPSGLDLAMKLHYLKIVYFFESEPAQGLTTPKVKESLFYLLNHYFIICGRFRRSESGRPIIKCNDCGVRFIEAKCKITLDEWLATIDWPSYKLLVSQQVIGPELSFSPPVLMQSNCQTG* |
ORF Type | complete |
Blastp | Protein ECERIFERUM 26 from Arabidopsis with 48.2% of identity |
---|---|
Blastx | Protein ECERIFERUM 26 from Arabidopsis with 48.2% of identity |
Eggnog | Transferase family(ENOG410YCVD) |
Kegg | Link to kegg annotations (AT4G13840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460619.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer