| Transcript | Ll_transcript_432039 |
|---|---|
| CDS coordinates | 3-332 (+) |
| Peptide sequence | SNLKPIETAIATRRGSSGHKQNTKSLPATTSTMSSDSPVSPTASGSTTARPASPKPPGGPATAIRRRAAADRADKVANARPSSTRAAGAGGSSSTMLKLYTDESPGLKVD |
| ORF Type | internal |
| Blastp | Protein transport protein Sec61 subunit beta from Yarrowia with 65.52% of identity |
|---|---|
| Blastx | Protein transport protein Sec61 subunit beta from Yarrowia with 65.52% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YALI0F08481g) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017424405.1) |
| Pfam | Sec61beta family (PF03911.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer