Protein coding transcript 34807

• Transcript: Ll_transcript_311484
• CDS coordinates: 95-460 (+)
• Peptide sequence: MHCQLSGQLLTAYGYGAPEFESGIYTYQSDVYSFGVVMLELLTGRQSHDRTRPRGEQFLVRWAVPQLHDIEALSSMVDPSLNGRYPAKSLSNFADIISRCLQVVSGLNINVLAQLSPISCN*
• ORF Type: complete

Annotations of Ll_transcript_311484

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 3 from Arabidopsis with 85.86% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 3 from Arabidopsis with 68.09% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G03390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412912.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;