Protein coding transcript 34861

• Transcript: Ll_transcript_308846
• CDS coordinates: 1601-1945 (+)
• Peptide sequence: MFFCGRLFLVGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKYFIRQTAAKKERKRSSIHDITTVDTNSVSAPMDQNWVPPPGAPMQQSQEMQYNPINNLHDQMGGFGYSNYGF*
• ORF Type: complete

Annotations of Ll_transcript_308846

• Blastp: Transcription factor SRM1 from Arabidopsis with 75% of identity
• Blastx: Transcription factor SRM1 from Arabidopsis with 75% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (AT5G08520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451314.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;