Protein coding transcript 34945

• Transcript: Ll_transcript_309314
• CDS coordinates: 836-1540 (+)
• Peptide sequence: MEISAMASTTPSSTSSLTLNTFCKPPHLKHSHISLPTSTTISLLTLFSPPYEAKAISKDQILSSLTQVEKTIDQVQEVGSSFLDSSQRAFEAIGSALKPAIETVLPFVQQAGEEALKVASPVISEVAKKAQEALQSSGVDAQPVLKTVADAAEQTTKVIEVAKPIASTTVETLSSSDPTVIAGTAGALFIAYLLFPPIWSAISFNFRGYKGTFDMLFILLHVCMTTQNHCMNEF*
• ORF Type: complete

Annotations of Ll_transcript_309314

• Blastp: Calcium sensing receptor, chloroplastic from Arabidopsis with 59.13% of identity
• Blastx: Calcium sensing receptor, chloroplastic from Arabidopsis with 51.5% of identity
• Eggnog: Calcium sensing receptor(ENOG4111GSH)
• Kegg: Link to kegg annotations (AT5G23060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439138.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;