Protein coding transcript 34946

• Transcript: Ll_transcript_309317
• CDS coordinates: 836-1210 (+)
• Peptide sequence: MEISAMASTTPSSTSSLTLNTFCKPPHLKHSHISLPTSTTISLLTLFSPPYEAKAISKDQILSSLTQVKYNKVHHFQQIYSTCMHAHYFKLRFFVVVVRWRKRSIRFRKWVPVFWTVHSVLLKL*
• ORF Type: complete

Annotations of Ll_transcript_309317

• Blastp: Calcium sensing receptor, chloroplastic from Arabidopsis with 47.56% of identity
• Blastx: Calcium sensing receptor, chloroplastic from Arabidopsis with 67.53% of identity
• Eggnog: Calcium sensing receptor(ENOG4111GSH)
• Kegg: Link to kegg annotations (AT5G23060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463659.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;