Transcript | Ll_transcript_309310 |
---|---|
CDS coordinates | 836-1324 (+) |
Peptide sequence | MEISAMASTTPSSTSSLTLNTFCKPPHLKHSHISLPTSTTISLLTLFSPPYEAKAISKDQILSSLTQVEKTIDQVQEVGSSFLDSSQRAFEAIGSALKPAIETVLPFVQQAGEEALKVASPVISEVAKKAQEALQSSGVDAQPVLKRPHFKTPSHDWSSLIY* |
ORF Type | complete |
Blastp | Calcium sensing receptor, chloroplastic from Arabidopsis with 59.86% of identity |
---|---|
Blastx | Calcium sensing receptor, chloroplastic from Arabidopsis with 63.64% of identity |
Eggnog | Calcium sensing receptor(ENOG4111GSH) |
Kegg | Link to kegg annotations (AT5G23060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463659.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer