Protein coding transcript 35012

• Transcript: Ll_transcript_311351
• CDS coordinates: 1-780 (+)
• Peptide sequence: LAKHNMDNRIAIANCGAISLLVDLLRSTDTKIQENAVTALLNLSINDNNKAAIATAGAIEPLIHVLETGSAEAKENSAATLFSLSVIEENKITIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKNRIVQAGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQECGIPVLVEVVELGSARGKENAAAALLHLCLHSNRFLSMVLQEGAVPPLVALSQSGTPRAKEKAQALLNQFRSQRHGNSGRN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_311351

• Blastp: U-box domain-containing protein 4 from Arabidopsis with 84.88% of identity
• Blastx: U-box domain-containing protein 4 from Arabidopsis with 84.88% of identity
• Eggnog: U-box domain-containing protein 4-like(ENOG410XU9Y)
• Kegg: Link to kegg annotations (AT2G23140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419372.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;