Protein coding transcript 35169

• Transcript: Ll_transcript_310319
• CDS coordinates: 132-1361 (+)
• Peptide sequence: MVSLTHLCLFFIILLHLHTIITCEEICETMSCGEIDIEFPFSLKGANGSCNNPDPSFQLSCDNNSRTILTLPNSGDLLVKRINYEKQVIQVNDPNGCLPKRYLQNFTFSISLPFIFDVTVYDFYDLVFVKCPSNLSDSISLPSISCLRETNASSSSSSYYYSFFRHYVNVSDSSSVFYGCEVISSSVAVPLPTMMTWPNLNRDIELIWDIPICEDCAARSQLCGFVNTSTFQVGCIFDPNHTTGVSKSLKYGLSIGLGIPALLCMIGLSCFIYKKFKIHHGPNTELPSNISVFNLQLQPGNLTAGLDGPEIEKFPKTLIGESGRLPKPNNNICPICLCDYEPKEMLRTIPECNHYFHASCIDEWLKMNATCPLCRNSPDAASSNVASSSSSSSSRTIDNPSPNHTFHTT*
• ORF Type: complete

Annotations of Ll_transcript_310319

• Blastp: Putative RING-H2 finger protein ATL21A from Arabidopsis with 32.89% of identity
• Blastx: Putative RING-H2 finger protein ATL21A from Arabidopsis with 32.88% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G46495)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446495.1)
• Pfam: Wall-associated receptor kinase galacturonan-binding (PF13947.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;