Protein coding transcript 35170

• Transcript: Ll_transcript_310320
• CDS coordinates: 132-890 (+)
• Peptide sequence: MVSLTHLCLFFIILLHLHTIITCEEICETMSCGEIDIEFPFSLKGANGSCNNPDPSFQLSCDNNSRTILTLPNSGDLLVKRINYEKQVIQVNDPNGCLPKRYLQNFTFSISLPFIFDVTVYDFYDLVFVKCPSNLSDSISLPSISCLRETNASSSSSSYYYSFFRHYVNVSDSSSVFYGCEVISSSVAVPLPTMMTWPNLNRDIELIWDIPICEDCAARSQLCGFVNTSTFQVGCIFDPNHTTGMPHSSFSL*
• ORF Type: complete

Annotations of Ll_transcript_310320

• Blastp: RING-H2 finger protein ATL22 from Arabidopsis with 33.47% of identity
• Blastx: Putative RING-H2 finger protein ATL69 from Arabidopsis with 47.69% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G25410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446495.1)
• Pfam: Wall-associated receptor kinase galacturonan-binding (PF13947.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;