Protein coding transcript 35234

• Transcript: Ll_transcript_309821
• CDS coordinates: 2-1186 (+)
• Peptide sequence: FLSLTHSFSSSPPPPPSPPPPHPEDSAILQRLHHKDWLTPKEVTTLLNSLTHHSSAVTLLHLYSSRKDFNLTEPFCVSLITRLARAKLIHPIQSLLQTLAHEKKLRRFSEDFFYSVIKLYAHSLNRIDKAVDTLYAMPSFRCVPSTKTFNFVLNLLVSARVYEVVHKVYASAGRLGVEVDACCLNILIKGLCESGKLEAAYKVFDEFPKSGLERNVRTFATLMDGLCEKGRVEEAIELLEVMERSGVSGDTIVYNVVIKGLRKKGMVEEGKQMLERMMRKGCYPSGSSYQEVLYGLLDAERFSEAKDLMERMVLKERVSPSFVSYKVMIKGLCKRNLVEDVDWAVRQMVLQGFAPRMGMWKQIVKCMVSQEITSNCVSVEEILEDTVPISLPCN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_309821

• Blastp: Pentatricopeptide repeat-containing protein At3g14580, mitochondrial from Arabidopsis with 48.02% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g14580, mitochondrial from Arabidopsis with 48.02% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G14580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443824.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;