Protein coding transcript 35253

• Transcript: Ll_transcript_309842
• CDS coordinates: 704-1030 (+)
• Peptide sequence: MRFNVQNAYWLSDRIRDKIIQMEKNRINKDGELVISSTKTRTQKGNIDDALAKLQEIIDAASYVPPPPSEEQKKKIAKMAAIGEHKRLKSKKVLSDKKAFRRSKNSWD*
• ORF Type: complete

Annotations of Ll_transcript_309842

• Blastp: Peptidyl-tRNA hydrolase ICT1, mitochondrial from Salmo with 40.2% of identity
• Blastx: Peptidyl-tRNA hydrolase ICT1, mitochondrial from Mus with 43.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100196025)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446666.1)
• Pfam: RF-1 domain (PF00472.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;