Transcript | Ll_transcript_309842 |
---|---|
CDS coordinates | 704-1030 (+) |
Peptide sequence | MRFNVQNAYWLSDRIRDKIIQMEKNRINKDGELVISSTKTRTQKGNIDDALAKLQEIIDAASYVPPPPSEEQKKKIAKMAAIGEHKRLKSKKVLSDKKAFRRSKNSWD* |
ORF Type | complete |
Blastp | Peptidyl-tRNA hydrolase ICT1, mitochondrial from Salmo with 40.2% of identity |
---|---|
Blastx | Peptidyl-tRNA hydrolase ICT1, mitochondrial from Mus with 43.18% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (100196025) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446666.1) |
Pfam | RF-1 domain (PF00472.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer