Transcript | Ll_transcript_308994 |
---|---|
CDS coordinates | 96-680 (+) |
Peptide sequence | MATTTNITFKMAYIIALVFALRCYGASGQSLAPESATAPSSDGVGGCFTVLVNMSNCLTFVEDGSNLTKPEKGCCPELAGLVDSNPICLCELLGKPDFVGVKLNLNKALKLPSLCHVSTPPVSTCSALGIPVASPASEDSISPSPSNGVVGSGPSSSETAANPSANKNKGALDFEASPMTFIFGLAMVFVSILF* |
ORF Type | complete |
Blastp | Non-specific lipid transfer protein GPI-anchored 2 from Arabidopsis with 41.18% of identity |
---|---|
Blastx | Xylogen-like protein 11 from Arabidopsis with 45.3% of identity |
Eggnog | lipid-transfer protein-like protein(ENOG410YY93) |
Kegg | Link to kegg annotations (AT3G43720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439199.1) |
Pfam | Probable lipid transfer (PF14368.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer