Transcript | Ll_transcript_311138 |
---|---|
CDS coordinates | 33-860 (+) |
Peptide sequence | MNNNKENNANESMQDSLALPMLPPTVELRPKENIPFMIHKQQIQSYEESTRNDNEFGLVTSDSLLNPSQKSSTFLNTKTFSPSSQNQDTEPQHSLRHFIDDCPNDDMRTDQTQLSISIPMAASSDFMSFSSSTTNEKLTLSPLRLSRELDPIQMCLGVGSGINESNSRQANWVPITWESCSMGGPLGEVLNLSNNNNNASEHCSRNSSALNLMTEGWDSSPPIGSSSPTGILQKTAFGSLSNSSAGSSPRADNNKTQEGATLCNDLLGSAMKPLL* |
ORF Type | complete |
Blastp | Growth-regulating factor 1 from Arabidopsis with 36.82% of identity |
---|---|
Blastx | Growth-regulating factor 1 from Arabidopsis with 39.11% of identity |
Eggnog | growth-regulating factor(ENOG4111S3M) |
Kegg | Link to kegg annotations (AT2G22840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413799.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer