Protein coding transcript 35490

• Transcript: Ll_transcript_311143
• CDS coordinates: 263-910 (+)
• Peptide sequence: MDLGVVGFDGLVGSNTTSTTTDGFVSLALDPETKYKGYGSGGFLKQERSSTITDEDEWRSSKLAKTHGDLFASPSKAMLLQERDSLLRSNSNNNATLFCDGQQMLSFSSPKSETSSNATLHFSYHPYSRDTGYSSGSMHGAITGARGLFTPSQWMELEHQALIYKYITANVPVPSHLLFPIRKALDSAGFCNFSNGVFRSNACMLMFLSFNNVHK*
• ORF Type: complete

Annotations of Ll_transcript_311143

• Blastp: Growth-regulating factor 1 from Arabidopsis with 46.94% of identity
• Blastx: Growth-regulating factor 8 from Oryza sativa with 53.19% of identity
• Eggnog: growth-regulating factor(ENOG4111S3M)
• Kegg: Link to kegg annotations (AT2G22840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413799.1)
• Pfam: QLQ (PF08880.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;