Protein coding transcript 35501

• Transcript: Ll_transcript_311142
• CDS coordinates: 467-1294 (+)
• Peptide sequence: MNDNKENDASERMQDSSSLPMLPPTLELKPKENIPFMIHKQQIPSYEESTRNDNEFGLVTSDSLLNPSQKSSTLLSSRTFSSSQNQETEPQHSLRHFIDDCPNDDMQSDSTQLSISIPMAASSDFISFSSSTRTDEKLTLSPLRLSRELDPIQMSLGTGSSIDESNIRQANWIPITWESCSMGGPLGEVLNLSNNNNNNASDHCSKNSSSLNLMTDGWDNSPPIGSSPTGILQKTAFGSLSNSSAGSSPRAETNKTQESATFCNELIGSTMKPLL*
• ORF Type: complete

Annotations of Ll_transcript_311142

• Blastp: Growth-regulating factor 1 from Arabidopsis with 38.75% of identity
• Blastx: Growth-regulating factor 1 from Arabidopsis with 37.5% of identity
• Eggnog: growth-regulating factor(ENOG4111S3M)
• Kegg: Link to kegg annotations (AT2G22840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436970.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;