Protein coding transcript 3553

• Transcript: Ll_transcript_519664
• CDS coordinates: 953-1534 (+)
• Peptide sequence: MCYQLKYPAPGAPNLAKRVKELLLASGLNHIDEEKKRGLDHGAWVPLMLMYPEADIPVCQLSLSSKRGATYHYNMGKALAPLKDEGVLIIGSGSATHNLSTIAPRTTPPAPWALAFMSWLKDSLLHGRYEEVNEYEEKAPYAKVAHPWPDHLFPLHVAMGAAGENAKTQIVHDSWDGGSFSYASFGFTAATST*
• ORF Type: complete

Annotations of Ll_transcript_519664

• Blastp: 4,5-DOPA dioxygenase extradiol from Beta with 64.71% of identity
• Blastx: 4,5-DOPA dioxygenase extradiol from Beta with 61.27% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419399.1)
• Pfam: Catalytic LigB subunit of aromatic ring-opening dioxygenase (PF02900.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;