Protein coding transcript 35539

• Transcript: Ll_transcript_311068
• CDS coordinates: 1991-2377 (+)
• Peptide sequence: MMLLDSSMWMQSLYNQGARKFWVHNTGPLGCLPKILSLTQKKDLDSFGCLSSYNSAARLFNVALQHLTQKLGNQLNGATIVYVDIYAIKYDIITNAAKYGKQQAASSHLSINSMIQLEESRNSVLQKV*
• ORF Type: complete

Annotations of Ll_transcript_311068

• Blastp: GDSL esterase/lipase LIP-4 from Arabidopsis with 58.24% of identity
• Blastx: GDSL esterase/lipase At1g09390 from Arabidopsis with 61.97% of identity
• Eggnog: GDSL esterase lipase(ENOG410YG8Q)
• Kegg: Link to kegg annotations (AT1G56670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422444.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;