| Transcript | Ll_transcript_311069 |
|---|---|
| CDS coordinates | 182-496 (+) |
| Peptide sequence | MIHSQNLTFLLLLLFTFSSSSAIGLNNPNKPAVLFVFGDSNSDTGGLASGLGFPVNFPNGRTFFHRSTGRLSDGRLIIDLLCKSIHTFIGYCDRDYCIVTSLYK* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | GDSL esterase/lipase LIP-4 from Arabidopsis with 63.77% of identity |
| Eggnog | GDSL esterase lipase(ENOG410YG8Q) |
| Kegg | Link to kegg annotations (AT1G56670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422444.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer