Transcript | Ll_transcript_311069 |
---|---|
CDS coordinates | 182-496 (+) |
Peptide sequence | MIHSQNLTFLLLLLFTFSSSSAIGLNNPNKPAVLFVFGDSNSDTGGLASGLGFPVNFPNGRTFFHRSTGRLSDGRLIIDLLCKSIHTFIGYCDRDYCIVTSLYK* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | GDSL esterase/lipase LIP-4 from Arabidopsis with 63.77% of identity |
Eggnog | GDSL esterase lipase(ENOG410YG8Q) |
Kegg | Link to kegg annotations (AT1G56670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422444.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer