Transcript | Ll_transcript_309043 |
---|---|
CDS coordinates | 2876-3304 (+) |
Peptide sequence | MAIVMALLSGFAGVYTEAIIKKRPSRDINVQNFWLYIFGMGFNAVAILVQDFDAVMNKGFFHGYSFVTVLMIFNHALSGIAVSMVMKYADNIVKVYSTSVAMILTAIVSVFLFGFHLSLAFFLGTIVVSVAIYLHSAGKIQR* |
ORF Type | complete |
Blastp | CMP-sialic acid transporter 2 from Oryza sativa with 90.07% of identity |
---|---|
Blastx | CMP-sialic acid transporter 4 from Arabidopsis with 69.19% of identity |
Eggnog | membrane(COG0697) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460204.1) |
Pfam | Nucleotide-sugar transporter (PF04142.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer