Protein coding transcript 35569

• Transcript: Ll_transcript_309060
• CDS coordinates: 465-1148 (+)
• Peptide sequence: MISSGINLVMTVIGFVVSTMFIVFICTRLICARIHLNASRRSFPVAARSNLSIMERGCHGLERAAVAKFPTKKYSDKFFSDAENTQCPVCLSEYQGEDLLHILPYCEHSFHVTCIDLWLQQNSTCPVCRISLREFPERKRLMQPMFSFTLRPQHSMESFDTDHYHCMMTNNGLSSRTPDNNRANPIQEDHFPPEGGLAVARDNIACLSQGGLIKDEGKKHVESPSNF*
• ORF Type: complete

Annotations of Ll_transcript_309060

• Blastp: RING-H2 finger protein ATL32 from Arabidopsis with 36.51% of identity
• Blastx: E3 ubiquitin-protein ligase ATL59 from Arabidopsis with 29.55% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G40070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429157.1)
• Pfam: RING-H2 zinc finger domain (PF12678.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;