Protein coding transcript 35572

• Transcript: Ll_transcript_309044
• CDS coordinates: 2973-3464 (+)
• Peptide sequence: MDTSHSDNYFLVTIIQFCRMCRCSICLSEYQGDDVLRILPYCGHSFHVSCIDIWLQQNSTCPVCRISLRGFPERKQLMQPLSSSALRLHYSMESFDSDHYYCMMTNNGLSSPIPENNAANTTPEGHFPPEGGLEPARDTITCLSPGDIIKDERKKHVESPSNF*
• ORF Type: complete

Annotations of Ll_transcript_309044

• Blastp: E3 ubiquitin-protein ligase ATL59 from Arabidopsis with 36.73% of identity
• Blastx: RING-H2 finger protein ATL34 from Arabidopsis with 39.13% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G10160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433202.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;