Protein coding transcript 35588

• Transcript: Ll_transcript_311440
• CDS coordinates: 1982-2347 (+)
• Peptide sequence: MIVQVQQQLQMRIEAQGKYLQKIIEEQQKLGSTLATTETLPSSHDKQNHPQSEPSESSDAFAGALSPLKKQKIDDVSKDGSTASRVPTKNAQKTDCSAGKPDPKLYEDDAGFGFDLDSEKD*
• ORF Type: complete

Annotations of Ll_transcript_311440

• Blastp: Myb family transcription factor PHL7 from Arabidopsis with 33.33% of identity
• Blastx: Myb family transcription factor PHL7 from Arabidopsis with 52.94% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG4111GBR)
• Kegg: Link to kegg annotations (AT2G01060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429451.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;