Protein coding transcript 356

• Transcript: Ll_transcript_513835
• CDS coordinates: 3-482 (+)
• Peptide sequence: TSEGQKPAGKKAKKVPEGEEDRSNDPSIGVGSVAAGGRYDNLVGMFSGKQQVPCVGISFGVERIFSITKQRLAADASAAAIRSNEVDVYVMAFGGKGFNGLLNERMQVARKLWDAGIKAEFSWKVKPKLPAQFKAAEVNGVPFAVILGDEELAAGKCRIK
• ORF Type: internal

Annotations of Ll_transcript_513835

• Blastp: Histidine--tRNA ligase, mitochondrial from Schizosaccharomyces with 60.26% of identity
• Blastx: Histidine--tRNA ligase, mitochondrial from Schizosaccharomyces with 56.97% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC2G2.12)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016196885.1)
• Pfam: Histidyl-tRNA synthetase (PF13393.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;