| Transcript | Ll_transcript_311325 |
|---|---|
| CDS coordinates | 213-623 (+) |
| Peptide sequence | MENPSSSGSGRWNKAGIGMEDNMLAMLDAFDSQDAVDDWIAFLDAVRASSIAFEHAKRPSSKIFGTVFHVLRTGKSLELIMASHKLLVDLEKHFPRVHLSGSDDSQPSSNSPSKLVVAEEAWSPIIFFFFFFFFSGE |
| ORF Type | 3prime_partial |
| Blastp | Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 42.61% of identity |
|---|---|
| Blastx | Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 41.96% of identity |
| Eggnog | NA(ENOG410XZEF) |
| Kegg | Link to kegg annotations (AT4G18470) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422776.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer