Protein coding transcript 35605

• Transcript: Ll_transcript_311326
• CDS coordinates: 1109-1846 (+)
• Peptide sequence: MKVICQLSQFQNELNKYAEFKKSSESQSPKYRQTALFLALPEVVKNTCVSMEKLLVMIMGLDFSKKKADIEGHTIRADGTRTPAMDIILDELAYSEDVVPLFLQIFTEPKWKLEIVVQYLWKYITKPSVRTRKTSGSTYDSTFHGALRCFSNKTGTKGIIKKMGADVVQFLLAHGFQAQLSILAEENRYDNHAGDQEGRANALSDLCQMFISAFDSLRSTNQHMEILPIGKEALFTAATVISMKS*
• ORF Type: complete

Annotations of Ll_transcript_311326

• Blastp: Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 39.81% of identity
• Blastx: Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 45.08% of identity
• Eggnog: NA(ENOG410XZEF)
• Kegg: Link to kegg annotations (AT4G18470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422776.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;