Transcript | Ll_transcript_311326 |
---|---|
CDS coordinates | 1109-1846 (+) |
Peptide sequence | MKVICQLSQFQNELNKYAEFKKSSESQSPKYRQTALFLALPEVVKNTCVSMEKLLVMIMGLDFSKKKADIEGHTIRADGTRTPAMDIILDELAYSEDVVPLFLQIFTEPKWKLEIVVQYLWKYITKPSVRTRKTSGSTYDSTFHGALRCFSNKTGTKGIIKKMGADVVQFLLAHGFQAQLSILAEENRYDNHAGDQEGRANALSDLCQMFISAFDSLRSTNQHMEILPIGKEALFTAATVISMKS* |
ORF Type | complete |
Blastp | Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 39.81% of identity |
---|---|
Blastx | Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 45.08% of identity |
Eggnog | NA(ENOG410XZEF) |
Kegg | Link to kegg annotations (AT4G18470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422776.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer