Protein coding transcript 35647

• Transcript: Ll_transcript_311199
• CDS coordinates: 78-725 (+)
• Peptide sequence: MDLSKTVDLARNFAVMVRVRGPDPKGMKMRRHAFHQYRSGETTLSASGMLVPDTLSDTQSAKLLYDDKSDGRVLVLTVASLVEPFLSPQHRHNIPQDRPKLIPGVRIDIMTEKTNENSSQGTPSWLGAQLLSLVDIPASALCLQSLIEASSGSPEHEWEVGWSLASNSNDNKPSKDFFRTQVLAEFFWNIHLHRWITQEDWKWENLAVRVLCANH*
• ORF Type: complete

Annotations of Ll_transcript_311199

• Blastp: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 57.3% of identity
• Blastx: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 57.3% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT1G28320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419712.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;