Protein coding transcript 35655

• Transcript: Ll_transcript_311206
• CDS coordinates: 1738-2217 (+)
• Peptide sequence: MQGRLEVGESGSASLVCKSLTRMAILSVSLSLKDVVGSTVSSINKRGDSLLAVGSPFGVLSPTHFFNSISVGRIANCYPPYSSDISLLMADIRSLPGMEGSPVFSEDACLTGIMIRPLRQKTSGAEIQSLVTAGDSMGCHCGCFQWLAAEVASERAFRF*
• ORF Type: complete

Annotations of Ll_transcript_311206

• Blastp: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 56.35% of identity
• Blastx: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 48.05% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT1G28320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003593618.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;