Transcript | Ll_transcript_310834 |
---|---|
CDS coordinates | 341-1060 (+) |
Peptide sequence | MSEYGFKNVLSIDEYASLFENIDPLAPYKKWTTKLAAVQNAEFNEGAPRNDVFSERVKAAFVVSDPVDWSRDIQVLCDILKTGGLPGRNVGPQPHLYFANDDLEYQTAFPSERLGLGAFRIALESIFNKIHHHPLEYTSFGKPHPSVFRNAETVLQQLVPQIHDDPHNNAQNFKTLYMIGDNPVVDIRGARQTGHPWFSILTRTGVFKGKGNHDQFPADLVVDTVEEAVDYILTKECAS* |
ORF Type | complete |
Blastp | Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c from Schizosaccharomyces with 33.05% of identity |
---|---|
Blastx | Uncharacterized protein YKR070W from Saccharomyces with 30.98% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC22A12.08c) |
CantataDB | Link to cantataDB annotations (CNT0002221) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447918.1) |
Pfam | HAD-hyrolase-like (PF13242.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer