Transcript | Ll_transcript_310827 |
---|---|
CDS coordinates | 341-691 (+) |
Peptide sequence | MSEYGFKNVLSIDEYASLFENIDPLAPYKKWTTKLAAVQNAEFNEGAPRNDVFSERVKAAFVVSDPVDWSRDIQVLCDILKTGGLPGRNVGPQPHLYFANDDLEYQVPKKLDRFSF* |
ORF Type | complete |
Blastp | Haloacid dehalogenase-like hydrolase domain-containing 5 from Homo with 30.43% of identity |
---|---|
Blastx | Uncharacterized protein YKR070W from Saccharomyces with 33.83% of identity |
Eggnog | Hydrolase(COG0647) |
Kegg | Link to kegg annotations (27440) |
CantataDB | Link to cantataDB annotations (CNT0002221) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447918.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer